Recombinant Human SNRNP25 protein (ab107142)

Overview

  • Product nameRecombinant Human SNRNP25 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BV90
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDVFQEGLAMVVQDPLLCDLPIQVTLEEVN SQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAI QRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNR DEVSFIKKLRQK
    • Molecular weight17 kDa including tags
    • Amino acids1 to 132
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab107142 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 3300001G02Rik
    • AL033324
    • C16ORF33
    • FLJ22940
    • Minus-99 protein
    • OTTMUSP00000005540
    • OTTMUSP00000034622
    • OTTMUSP00000034623
    • RGD1310922
    • RP23-177M10.3
    • small nuclear ribonucleoprotein 25kDa (U11/U12)
    • SNR25_HUMAN
    • Snrnp25
    • U11/U12 small nuclear ribonucleoprotein 25 kDa protein
    • U11/U12 snRNP 25 kDa protein
    • U11/U12-25K
    • Z69719.2-001
    see all
  • Sequence similaritiesContains 1 ubiquitin-like domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNRNP25 protein images

  • 15% SDS-PAGE showing ab107142 (3 µg) at approximately 17.4 kDa.

References for Recombinant Human SNRNP25 protein (ab107142)

ab107142 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"