Recombinant Human SNRPA1 protein (ab116200)

Overview

  • Product nameRecombinant Human SNRPA1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP09661
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMVKLTAELIEQAAQYTNAVRDRELDLRGYK IPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG EGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKH YRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIP GRERRSGPTDDGEEEMEEDTVTNGS
    • Molecular weight31 kDa including tags
    • Amino acids1 to 255
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 80 % SDS-PAGE.
    ab116200 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride, 0.03% DTT, 0.002% PMSF

General Info

  • Alternative names
    • Lea1
    • RU2A_HUMAN
    • Small nuclear ribonucleoprotein polypeptide A
    • SNRPA1
    • U2 small nuclear ribonucleoprotein A''
    • U2 small nuclear ribonucleoprotein polypeptide A'
    • U2 snRNP A
    • U2 snRNP A''
    see all
  • FunctionThis protein is associated with sn-RNP U2. It helps the A' protein to bind stem loop IV of U2 snRNA.
  • Sequence similaritiesBelongs to the U2 small nuclear ribonucleoprotein A family.
    Contains 4 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNRPA1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab116200.

References for Recombinant Human SNRPA1 protein (ab116200)

ab116200 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"