Recombinant Human SNRPA1 protein (ab116200)

Overview

  • Product name
    Recombinant Human SNRPA1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMVKLTAELIEQAAQYTNAVRDRELDLRGYK IPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIG EGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKH YRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIP GRERRSGPTDDGEEEMEEDTVTNGS
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 255
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    ab116200 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride, 0.03% DTT, 0.002% PMSF

General Info

  • Alternative names
    • Lea1
    • RU2A_HUMAN
    • Small nuclear ribonucleoprotein polypeptide A
    • SNRPA1
    • U2 small nuclear ribonucleoprotein A''
    • U2 small nuclear ribonucleoprotein polypeptide A'
    • U2 snRNP A
    • U2 snRNP A''
    see all
  • Function
    This protein is associated with sn-RNP U2. It helps the A' protein to bind stem loop IV of U2 snRNA.
  • Sequence similarities
    Belongs to the U2 small nuclear ribonucleoprotein A family.
    Contains 4 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116200.

References

ab116200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up