Overview

  • Product nameRecombinant Human SNRPB protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP14678
    • SpeciesHuman
    • SequenceMTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRK IKPKNSKQAEREEKRVLGLVLLRGENLVSM
    • Molecular weight34 kDa including tags
    • Amino acids1 to 80

Specifications

Our Abpromise guarantee covers the use of ab117001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • B polypeptide of Sm protein
    • COD
    • RSMB_HUMAN
    • Sm B/B'
    • Sm B/Sm B'
    • Sm B/SmB'
    • Sm protein B/B''
    • Sm-B/B''
    • Small nuclear ribonucleoprotein polypeptide B
    • Small nuclear ribonucleoprotein polypeptide B/B'
    • Small nuclear ribonucleoprotein polypeptides B and B'
    • Small nuclear ribonucleoprotein polypeptides B and B1
    • Small nuclear ribonucleoprotein-associated proteins B and B''
    • SmB
    • SmB/B''
    • SmB/Sm B'
    • SmB/SmB'
    • snRNP B
    • snRNP-B
    • snRNPB
    • SNRPB
    • SNRPB1
    see all
  • FunctionAppears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. May have a functional role in the pre-mRNA splicing or in snRNP structure. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
  • Sequence similaritiesBelongs to the snRNP SmB/SmN family.
  • Post-translational
    modifications
    Methylated. Arg-108 and Arg-112 are dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNRPB protein images

  • 12.5% SDS-PAGE showing ab117001 at approx. 34.43 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SNRPB protein (ab117001)

ab117001 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"