Overview

  • Product name
    Recombinant Human SNRPB protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRK IKPKNSKQAEREEKRVLGLVLLRGENLVSM
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 80

Specifications

Our Abpromise guarantee covers the use of ab117001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • B polypeptide of Sm protein
    • COD
    • RSMB_HUMAN
    • Sm B/B'
    • Sm B/Sm B'
    • Sm B/SmB'
    • Sm protein B/B''
    • Sm-B/B''
    • Small nuclear ribonucleoprotein polypeptide B
    • Small nuclear ribonucleoprotein polypeptide B/B'
    • Small nuclear ribonucleoprotein polypeptides B and B'
    • Small nuclear ribonucleoprotein polypeptides B and B1
    • Small nuclear ribonucleoprotein-associated proteins B and B''
    • SmB
    • SmB/B''
    • SmB/Sm B'
    • SmB/SmB'
    • snRNP B
    • snRNP-B
    • snRNPB
    • SNRPB
    • SNRPB1
    see all
  • Function
    Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. May have a functional role in the pre-mRNA splicing or in snRNP structure. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
  • Sequence similarities
    Belongs to the snRNP SmB/SmN family.
  • Post-translational
    modifications
    Methylated. Arg-108 and Arg-112 are dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117001 at approx. 34.43 kDa.
    Stained with Coomassie Blue.

References

ab117001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up