Recombinant Human SNRPB2 protein (ab107134)

Overview

  • Product name
    Recombinant Human SNRPB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDIRPNHTIYINNMNDKIKKEELKRSLYAL FSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMR IQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPN SANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEV RLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 225
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab107134 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 2810052G09Rik
    • MGC24807
    • MGC45309
    • Msl1
    • OTTHUMP00000030324
    • OTTHUMP00000030325
    • OTTMUSP00000016621
    • OTTMUSP00000016622
    • RP23-371L4.1
    • RU2B_HUMAN
    • Small nuclear ribonucleoprotein polypeptide B
    • Small nuclear ribonucleoprotein polypeptide B2
    • SNRPB2
    • U2 small nuclear ribonucleoprotein B''
    • U2 snRNP B''
    • U2B''
    see all
  • Function
    Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA only in presence of the U2A' protein.
  • Sequence similarities
    Belongs to the RRM U1 A/B'' family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107134 (3µg).

References

ab107134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up