Recombinant Human SNRPB2 protein (ab107134)

Overview

  • Product nameRecombinant Human SNRPB2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP08579
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDIRPNHTIYINNMNDKIKKEELKRSLYAL FSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMR IQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPN SANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEV RLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
    • Molecular weight28 kDa including tags
    • Amino acids1 to 225
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab107134 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 2810052G09Rik
    • MGC24807
    • MGC45309
    • Msl1
    • OTTHUMP00000030324
    • OTTHUMP00000030325
    • OTTMUSP00000016621
    • OTTMUSP00000016622
    • RP23-371L4.1
    • RU2B_HUMAN
    • Small nuclear ribonucleoprotein polypeptide B2
    • SNRPB2
    • U2 small nuclear ribonucleoprotein B''
    • U2 snRNP B''
    see all
  • FunctionInvolved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA only in presence of the U2A' protein.
  • Sequence similaritiesBelongs to the RRM U1 A/B'' family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNRPB2 protein images

  • 15% SDS-PAGE showing ab107134 (3µg).

References for Recombinant Human SNRPB2 protein (ab107134)

ab107134 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"