Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP09234
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMPKFYCDYCDTYLTHDSPSVRKTHCSG RKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMI PPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP GMRPP MGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
    • Molecular weight20 kDa including tags
    • Amino acids1 to 159
    • TagsHis tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    purified by using conventional chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 50% Glycerol, 1.75% Sodium chloride, 0.08% DTT, 5.84% EDTA

General Info

  • Alternative names
    • FLJ20302
    • OTTHUMP00000016238
    • OTTMUSP00000026897
    • RU1C_HUMAN
    • Small nuclear ribonucleoprotein polypeptide C
    • Snrpc
    • U1 C
    • U1 small nuclear ribonucleoprotein 1C
    • U1 small nuclear ribonucleoprotein C
    • U1 small nuclear RNP specific C
    • U1 snRNP C
    • U1 snRNP protein C
    • U1-C
    • U1C
    • U1C protein
    • Yhc1
    see all
  • FunctionThis protein is associated with snRNP U1.
  • Sequence similaritiesBelongs to the U1 small nuclear ribonucleoprotein C family.
    Contains 1 matrin-type zinc finger.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNRPC protein images

  • 15% SDS-PAGE showing ab116159 at approximately 19.8kDa (3µg)

References for Recombinant Human SNRPC protein (ab116159)

ab116159 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"