Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09234
    • SpeciesHuman
    • SequenceMPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLI DKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGP PMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPT RPGMTRPDR
    • Molecular weight44 kDa including tags
    • Amino acids1 to 159

Specifications

Our Abpromise guarantee covers the use of ab117010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20302
    • OTTHUMP00000016238
    • OTTMUSP00000026897
    • RU1C_HUMAN
    • Small nuclear ribonucleoprotein polypeptide C
    • Snrpc
    • U1 C
    • U1 small nuclear ribonucleoprotein 1C
    • U1 small nuclear ribonucleoprotein C
    • U1 small nuclear RNP specific C
    • U1 snRNP C
    • U1 snRNP protein C
    • U1-C
    • U1C
    • U1C protein
    • Yhc1
    see all
  • FunctionThis protein is associated with snRNP U1.
  • Sequence similaritiesBelongs to the U1 small nuclear ribonucleoprotein C family.
    Contains 1 matrin-type zinc finger.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNRPC protein images

  • 12.5% SDS-PAGE showing ab117010 at approximately 43.56 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SNRPC protein (ab117010)

ab117010 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"