Recombinant Human SNRPD3 protein (ab113120)

Overview

  • Product nameRecombinant Human SNRPD3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP62318
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSIGVPIKVLHEAEGHIVTCETNTGEVYRG KLIEAEDNMNCQMSNITV TYRDGRVAQLEQVYIRGSKIRFLILPDMLK NAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQ KRR
    • Molecular weight16 kDa including tags
    • Amino acids1 to 126
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab113120 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 2.92% Sodium chloride, 0.03% DTT, 0.002% PMSF

General Info

  • Alternative names
    • Sm D3
    • Sm-D3
    • small nuclear ribonucleoprotein D3 polypeptide 18kDa
    • Small nuclear ribonucleoprotein Sm D3
    • SmD3
    • SMD3_HUMAN
    • snRNP core protein D3
    • SNRPD3
    see all
  • FunctionAppears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
  • Sequence similaritiesBelongs to the snRNP core protein family.
  • Post-translational
    modifications
    Methylated on arginine residues by PRMT5 and PRMT7; methylation is required for assembly and biogenesis of snRNPs.
    Arg-97 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNRPD3 protein images

  • 15% SDS-PAGE analysis of ab113120 (3µg)

References for Recombinant Human SNRPD3 protein (ab113120)

ab113120 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"