Overview

  • Product name
    Recombinant Human SNRPF protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSLPLNPKPFLNGLTGKPVMVKLKWGMEYK GYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE
    • Molecular weight
      12 kDa including tags
    • Amino acids
      1 to 86
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab102559 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • PBSCF
    • Sm F
    • Sm protein F
    • Small nuclear ribonucleoprotein F
    • Small nuclear ribonucleoprotein polypeptide F
    • SMF
    • snRNP F
    • snRNPF
    see all
  • Relevance
    SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.
  • Cellular localization
    Nuclear

Images

  • 15% SDS-PAGE analysis of ab102559 (3 µg).

References

ab102559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up