Overview

  • Product nameRecombinant Human SNRPG protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP62308
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSKAHPPELKKFMDKKLSLKLNGGRHVQGI LRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
    • Molecular weight11 kDa including tags
    • Amino acids1 to 76
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab105596 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • MGC117317
    • RUXG_HUMAN
    • Sm protein G
    • Sm-G
    • Small nuclear ribonucleoprotein G
    • Small nuclear ribonucleoprotein polypeptide G
    • SmG
    • snRNP-G
    • SNRPG
    see all
  • FunctionAppears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.
  • Sequence similaritiesBelongs to the snRNP Sm proteins family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SNRPG protein images

  • 15% SDS-PAGE analysis of 3µg ab105596.

References for Recombinant Human SNRPG protein (ab105596)

ab105596 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"