Overview

  • Product name
    Recombinant Human SNRPG protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSKAHPPELKKFMDKKLSLKLNGGRHVQGI LRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 76
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab105596 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • MGC117317
    • RUXG_HUMAN
    • Sm protein G
    • Sm-G
    • Small nuclear ribonucleoprotein G
    • Small nuclear ribonucleoprotein polypeptide G
    • SmG
    • snRNP-G
    • SNRPG
    see all
  • Function
    Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.
  • Sequence similarities
    Belongs to the snRNP Sm proteins family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human SNRPG protein images

  • 15% SDS-PAGE analysis of 3µg ab105596.

References for Recombinant Human SNRPG protein (ab105596)

ab105596 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up