Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSL TGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPP RGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLA ADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREV TPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKM CFAARNLSMPDLENRQN
    • Amino acids
      1 to 267
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Syntrophin like
    • 59 kDa dystrophin associated protein A1 basic component 2
    • 59 kDa dystrophin-associated protein A1 basic component 2
    • Basic beta 2 syntrophin
    • Beta 2 syntrophin
    • Beta-2-syntrophin
    • D16S2531E
    • Dystrophin associated protein A1 59kD basic component 2
    • EST25263
    • SNT2B2
    • SNT3
    • Sntb2
    • SNTB2_HUMAN
    • SNTL
    • Syntrophin 3
    • Syntrophin beta 2 (dystrophin associated protein A1 59kDa basic component 2)
    • Syntrophin-3
    • Syntrophin-like
    see all
  • Function
    Adapter protein that binds to and probably organizes the subcellular localization of a variety of membrane proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. May play a role in the regulation of secretory granules via its interaction with PTPRN.
  • Tissue specificity
    Ubiquitous. Isoform 1 is the predominant isoform. Weak level of isoform 2 is present in all tested tissues, except in liver and heart where it is highly expressed.
  • Sequence similarities
    Belongs to the syntrophin family.
    Contains 1 PDZ (DHR) domain.
    Contains 2 PH domains.
    Contains 1 SU (syntrophin unique) domain.
  • Domain
    The PH 1 domain mediates the oligomerization in a calcium dependent manner.
    The PDZ domain binds to the last three or four amino acids of ion channels and receptor proteins. The association with dystrophin or related proteins probably leaves the PDZ domain available to recruit proteins to the membrane.
    The SU domain binds calmodulin in a calcium-dependent manner.
  • Post-translational
    modifications
    Phosphorylated. Partially dephosphorylated upon insulin stimulation.
  • Cellular localization
    Membrane. Cytoplasmic vesicle > secretory vesicle membrane. Cell junction. Cytoplasm > cytoskeleton. Membrane-associated. In muscle, it is exclusively localized at the neuromuscular junction (By similarity). In insulinoma cell line, it is enriched in secretory granules.
  • Information by UniProt

Images

  • ab159557 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up