Overview

  • Product nameRecombinant Human SNTN protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionA6NMZ2
    • SpeciesHuman
    • SequenceGSSHHHHHHSSGLVPRGSHMGGCMHSTQDKSLHLEGDPNPSAAPTSTCAP RKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLEKAI AKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSIT VMSDLLQNIRNVKIMK
    • Molecular weight19 kDa including tags
    • Amino acids1 to 147
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab107138 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50% Glycerol, 0.15M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • A430083B19Rik
    • FLJ44379
    • OTTHUMP00000213412
    • OTTHUMP00000213414
    • Protein S100-A1-like
    • RGD1562356
    • S100 calcium-binding protein A1-like
    • S100A1L
    • S100AL
    • Sentan
    • Sentan cilia apical structure protein
    • SNTAN_HUMAN
    • SNTN
    see all
  • FunctionMay be a component of the linker structure that bridges the ciliary membrane and peripheral singlet microtubules.
  • Sequence similaritiesBelongs to the S-100 family.
  • Cellular localizationCell projection > cilium. Expressed exclusively at the cilium tip where it localizes between the cell membrane and peripheral A-subfibers.
  • Information by UniProt

Recombinant Human SNTN protein images

  • 15% SDS-PAGE showing ab107138 (3µg).

References for Recombinant Human SNTN protein (ab107138)

ab107138 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"