Overview

  • Product name
    Recombinant Human SNTN protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GSSHHHHHHSSGLVPRGSHMGGCMHSTQDKSLHLEGDPNPSAAPTSTCAP RKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLEKAI AKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSIT VMSDLLQNIRNVKIMK
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 147
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab107138 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50% Glycerol, 0.15M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • A430083B19Rik
    • FLJ44379
    • OTTHUMP00000213412
    • OTTHUMP00000213414
    • Protein S100-A1-like
    • RGD1562356
    • S100 calcium-binding protein A1-like
    • S100A1L
    • S100AL
    • Sentan
    • Sentan cilia apical structure protein
    • SNTAN_HUMAN
    • SNTN
    see all
  • Function
    May be a component of the linker structure that bridges the ciliary membrane and peripheral singlet microtubules.
  • Sequence similarities
    Belongs to the S-100 family.
  • Cellular localization
    Cell projection > cilium. Expressed exclusively at the cilium tip where it localizes between the cell membrane and peripheral A-subfibers.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107138 (3µg).

References

ab107138 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up