Recombinant Human SNURPORTIN1 protein (ab117179)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEELSQALASSFSVSQDLNSTAAPHPRLSQ YKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEENK KDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRA LIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVN QTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFV GLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPY MVSDVLGVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASE NGHYELEHLSTPKLKGSSHSPDHPGCLMEN
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 360
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab117179 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    ab117179 although stable at 4°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.24% Tris, 0.03% DTT, 0.58% Sodium chloride, 10% Glycerol

General Info

  • Alternative names
    • 0610031A09Rik
    • KPNBL
    • MGC134006
    • MGC95000
    • RNA U transporter 1
    • RNA, U transporter 1
    • RNUT 1
    • RNUT1
    • SNUPN
    • Snupn1
    • Snurportin 1
    • Snurportin-1
    • Snurportin1
    • SPN1
    • SPN1_HUMAN
    • wu:fc41a03
    • zgc:77819
    see all
  • Function
    Functions as an U snRNP-specific nuclear import adapter. Involved in the trimethylguanosine (m3G)-cap-dependent nuclear import of U snRNPs. Binds specifically to the terminal m3G-cap U snRNAs.
  • Sequence similarities
    Belongs to the snurportin family.
    Contains 1 IBB domain.
  • Cellular localization
    Nucleus. Cytoplasm. Nucleoplasmic shuttling protein. Its nuclear import involves the nucleocytoplasmic transport receptor importin beta. It is re-exported to the cytoplasm by the XPO1-dependent nuclear export receptor pathway.
  • Information by UniProt

References for Recombinant Human SNURPORTIN1 protein (ab117179)

ab117179 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up