Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGGSMTVGITDPEKIGD GMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFI VPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQ DPDVREFLEKEELPRAVGTQTLSGAGLLKMFNKATDAVSKMTIKMNESDI WFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSS EDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVR AAFDQRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWE SRVTQYERDFERISTVVRKEVIRFEKEKSKDFKNHVIKYLETLLYSQQQL AKYWEAFLPEAKAIS
    • Molecular weight
      48 kDa including tags
    • Amino acids
      146 to 522
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101061 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • HsT17379
    • MGC8664
    • SNX 1
    • SNX 1a
    • Snx1
    • SNX1_HUMAN
    • SNX1A
    • Sorting nexin 1
    • Sorting nexin 1A
    • Sorting nexin-1
    • Vps5
    see all
  • Function
    May be involved in several stages of intracellular trafficking. Plays a role in targeting ligand-activated EGFR to the lysosomes for degradation after endocytosis from the cell surface and release from the Golgi. Component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)) or phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).
  • Sequence similarities
    Belongs to the sorting nexin family.
    Contains 1 BAR domain.
    Contains 1 PX (phox homology) domain.
  • Cellular localization
    Endosome membrane. Golgi apparatus > trans-Golgi network membrane. Early endosome membrane. Enriched on tubular elements of the early endosome membrane. Binds preferentially to highly curved membranes enriched in phosphatidylinositol 3-phosphate (PtdIns(3P)) or phosphatidylinositol 3,5-bisphosphate (PtdIn.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab101061 (3 µg).

References

ab101061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up