Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ13596
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGGSMTVGITDPEKIGD GMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFI VPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQ DPDVREFLEKEELPRAVGTQTLSGAGLLKMFNKATDAVSKMTIKMNESDI WFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSS EDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVR AAFDQRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWE SRVTQYERDFERISTVVRKEVIRFEKEKSKDFKNHVIKYLETLLYSQQQL AKYWEAFLPEAKAIS
    • Molecular weight48 kDa including tags
    • Amino acids146 to 522
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101061 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • HsT17379
    • MGC8664
    • SNX 1
    • SNX 1a
    • Snx1
    • SNX1_HUMAN
    • SNX1A
    • Sorting nexin 1
    • Sorting nexin 1A
    • Sorting nexin-1
    • Vps5
    see all
  • FunctionMay be involved in several stages of intracellular trafficking. Plays a role in targeting ligand-activated EGFR to the lysosomes for degradation after endocytosis from the cell surface and release from the Golgi. Component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)) or phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).
  • Sequence similaritiesBelongs to the sorting nexin family.
    Contains 1 BAR domain.
    Contains 1 PX (phox homology) domain.
  • Cellular localizationEndosome membrane. Golgi apparatus > trans-Golgi network membrane. Early endosome membrane. Enriched on tubular elements of the early endosome membrane. Binds preferentially to highly curved membranes enriched in phosphatidylinositol 3-phosphate (PtdIns(3P)) or phosphatidylinositol 3,5-bisphosphate (PtdIn.
  • Information by UniProt

Recombinant Human SNX1 protein images

  • 15% SDS-PAGE analysis of ab101061 (3 µg).

References for Recombinant Human SNX1 protein (ab101061)

ab101061 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"