Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEVLLSNGQKVLVNVL TSDQTEDVLE AVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQEF ELPYVSVTSLRSQEYKIVLRKS YWDSAYDDDVMENRVGLNLLYAQTVS DIERGWILVTKEQHRQLKSLQEKVSKKEFLRLAQ TLRHYGYLRFDACV ADFPEKDCPVVVSAGNSELSLQLRLPGQQLREGSFRVTRMRCWRVT SS VPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQWVTITSPQAIMMSICL QSMVDELM VKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLESPDA TRESMVKLSSKLSAVSLRGI GSPSTDASASDVHGNFAFEGIGDEDL
    • Amino acids85 to 470

Specifications

Our Abpromise guarantee covers the use of ab93997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 130 µl aqua dest.

General Info

  • Alternative names
    • Similar to a putative C elegans gene encoded in cosmid F17H10
    • Sorting nexin 17
  • RelevanceThe SNX17 gene encodes a member of the sorting nexin family. Members of this family are involved in intracellular trafficking, and contain a phox (PX) domain, which is a phosphoinositide binding domain. The protein contains a B41 domain, but does not contain a coiled coil region, like some family members. This protein interacts with the cytoplasmic domain of P-selectin, and may function in the intracellular trafficking of P-selectin.
  • Cellular localizationCytoplasm. Note=Associated with early endosomes.

Recombinant Human SNX17 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human SNX17 protein (ab93997)

ab93997 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab93997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"