Overview

  • Product name
    Recombinant Human SNX27 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRK WLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQG KMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEE GQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNY MHECFERVFCELKWRKEEY
    • Amino acids
      1 to 219
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0488
    • Methamphetamine responsive transcript 1
    • MGC126871
    • MGC126873
    • MGC20471
    • MRT1
    • MY014
    • OTTHUMP00000042487
    • RP11-98D18.12
    • SNX27
    • SNX27_HUMAN
    • Sorting nexin family member 27
    • Sorting nexin-27
    see all
  • Function
    Involved in endocytic trafficking (By similarity). In T lymphocytes, participates in endocytic recycling pathway. Recruits PSCDBP and HT4R to early endosomes.
  • Tissue specificity
    Expressed in cells of hematopoietic origin (at protein level).
  • Sequence similarities
    Belongs to the sorting nexin family.
    Contains 1 PDZ (DHR) domain.
    Contains 1 PX (phox homology) domain.
    Contains 1 Ras-associating domain.
  • Domain
    The PDZ domain mediates the interaction with DGKZ, PSCDBP and HT4R and is responsible for vesicular localization.
  • Cellular localization
    Cytoplasm > cytosol. Early endosome. In T-lymphocytes, recruited from the cytosol to sorting endosomes by phosphoinositide-3-kinase products.
  • Information by UniProt

Images

  • ab164350 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164350 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up