Overview

  • Product nameRecombinant Human SNX3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO60493
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAETVADTRRLITKPQNLNDAYGPPSNFLE IDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSE LERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVA GHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
    • Molecular weight21 kDa including tags
    • Amino acids1 to 162
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab109970 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Grd19
    • MCOPS8
    • MGC151262
    • MGC151266
    • MGC17570
    • OTTHUMP00000016941
    • OTTHUMP00000046475
    • OTTHUMP00000046476
    • Protein SDP3
    • SDP3
    • SNX3
    • SNX3_HUMAN
    • SNX3A
    • Sorting nexin 3
    • Sorting nexin 3A
    • Sorting nexin-3
    see all
  • FunctionPhosphoinositide-binding protein required for multivesicular body formation. Specifically binds phosphatidylinositol-3-phosphate (PtdIns(P3)). Plays a role in protein transport between cellular compartments. Promotes stability and cell surface expression of epithelial sodium channel (ENAC) subunits SCNN1A and SCNN1G (By similarity). Not involved in EGFR degradation.
  • Involvement in diseaseA chromosomal aberration involving SNX3 may be a cause of microphthalmia syndromic type 8 (MCOPS8) [MIM:601349]. Translocation t(6;13)(q21;q12). Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS8 is a very rare congenital syndrome characterized by microcephaly, microphthalmia, ectrodactyly of the lower limbs and prognathism. Intellectual deficit has been reported.
  • Sequence similaritiesBelongs to the sorting nexin family.
    Contains 1 PX (phox homology) domain.
  • DomainThe PX domain mediates specific binding to phosphatidylinositol-3-phosphate (PtdIns(P3)).
  • Post-translational
    modifications
    Ubiquitinated, leading to its proteasomal degradation. Deubiquitinated by USP10.
  • Cellular localizationEarly endosome.
  • Information by UniProt

Recombinant Human SNX3 protein images

  • 15% SDS-PAGE analysis of 3 µg ab109970.

References for Recombinant Human SNX3 protein (ab109970)

ab109970 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"