Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGL FPASYVEIVRSGISTNHADYSSSPAGSPGAQVSLYNSPSVASPARSGGGS GFLSNQGSFEEDDDDDWDDWDDGCTVVEEPRAGGLGTNGHPPLNLSYPGA YPSQHMAFRPKPPLERQDSLASAKRGSVVGRNLNRFSCFVRSGVEAFILG DVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTKFKGIKSYI SYKLTPTHAASPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEE DFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEK DEMVGASFLLTFQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVAS ELVRKHVGGFRKEFQKLGSAFQAISHSFQMDPPFCSEALNSAISHTGRTY EAIGEMFAEQPKNDLFQMLDTLSLYQGLLSNFPDIIHLQKGAFAKVKESQ RMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYL RQQILFYQRVGQQLEKTLRMYDNL
    • Amino acids
      1 to 574
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC32065
    • SH3 and PX domain containing 3
    • SH3 and PX domain containing protein 3
    • SH3 and PX domain-containing protein 3
    • SH3PX3
    • SH3PXD3C
    • SNX 30
    • SNX 33
    • SNX30
    • snx33
    • SNX33_HUMAN
    • Sorting nexin 33
    • Sorting nexin-33
    see all
  • Sequence similarities
    Belongs to the sorting nexin family.
    Contains 1 BAR domain.
    Contains 1 PX (phox homology) domain.
    Contains 1 SH3 domain.
  • Information by UniProt

Images

  • ab166081 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up