Overview

  • Product name
    Recombinant Human Snx6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILGRDLNFHVF LEYNQDLSVRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTF LLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDSTDICKF FLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRS LVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFK TRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT
    • Amino acids
      1 to 290
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Sorting Nexin 6
    • TFAF2
    • TRAF4 Associated Factor 2
  • Relevance
    Snx6 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associates with the long isoform of the leptin receptor, the transforming growth factor-beta family of receptor serine-threonine kinases, and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor. This protein may form oligomeric complexes with family member proteins through interactions of both the PX domain and the coiled coil regions of the molecules. Translocation of this protein from the cytoplasm to the nucleus occurs after binding to proviral integration site 1 protein. This gene results in two transcripts encoding two distinct isoforms.
  • Cellular localization
    Endosomes

Images

  • ab163697 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up