Recombinant Human SOAT 1 protein (ab114700)

Overview

  • Product name
    Recombinant Human SOAT 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYL YFLFAPTLIYRDSYPRNPTVRWG
    • Molecular weight
      34 kDa including tags
    • Amino acids
      249 to 321

Specifications

Our Abpromise guarantee covers the use of ab114700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACACT
    • ACAT
    • ACAT-1
    • ACAT1
    • Acyl coenzyme A cholesterol acyltransferase 1
    • Acyl-coenzyme A:cholesterol acyltransferase 1
    • Cholesterol acyltransferase 1
    • SOAT
    • SOAT1
    • SOAT1_HUMAN
    • STAT
    • Sterol O acyltransferase 1
    • Sterol O-acyltransferase 1
    see all
  • Function
    Catalyzes the formation of fatty acid-cholesterol esters. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114700 at approximately 33.66 kDa stained with Coomassie Blue.

References

ab114700 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114700.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up