Recombinant Human SOAT 1 protein (ab114700)

Overview

  • Product name
    Recombinant Human SOAT 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYL YFLFAPTLIYRDSYPRNPTVRWG
    • Molecular weight
      34 kDa including tags
    • Amino acids
      249 to 321

Specifications

Our Abpromise guarantee covers the use of ab114700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACACT
    • ACAT
    • ACAT-1
    • ACAT1
    • Acyl coenzyme A cholesterol acyltransferase 1
    • Acyl-coenzyme A:cholesterol acyltransferase 1
    • Cholesterol acyltransferase 1
    • SOAT
    • SOAT1
    • SOAT1_HUMAN
    • STAT
    • Sterol O acyltransferase 1
    • Sterol O-acyltransferase 1
    see all
  • Function
    Catalyzes the formation of fatty acid-cholesterol esters. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.
  • Sequence similarities
    Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human SOAT 1 protein images

  • 12.5% SDS-PAGE showing ab114700 at approximately 33.66 kDa stained with Coomassie Blue.

References for Recombinant Human SOAT 1 protein (ab114700)

ab114700 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114700.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up