Overview

  • Product name
    Recombinant Human SOCS4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAE TVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVG QCFPIKNCSSRHSSGLPSKRKIHISELMLDKCPFPPRSDLAFRWHFIKRH TAPINSKSDEWVSTDLSQTELRDGQLKRRNMEENINCFSHTNVQPCVITT DNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTSSRKRNKPKWD LDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPC VFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNC TTYDGIDALPIPSSMKLYLKEYHYKSKVRVLRIDAPEQQC
    • Amino acids
      1 to 440
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CIS4
    • Cish4
    • Cytokine inducible SH2 protein 4
    • DKFZp686J1568
    • HSPC060
    • SH2 domain containing SOCS box protein
    • SOCS-4
    • SOCS-7
    • SOCS4
    • SOCS4_HUMAN
    • SOCS6
    • SOCS7
    • SSI4
    • STAI4
    • STAT induced STAT inhibitor 4
    • STAT4
    • STATI4
    • Suppressor of cytokine signaling 4
    • Suppressor of cytokine signaling 7
    see all
  • Function
    SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes.
  • Information by UniProt

Images

  • ab153591 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up