Overview

  • Product name
    Recombinant Human SOCS7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHL CRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLIS KQKQEVEPST
    • Amino acids
      472 to 581
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ash and phospholipase C gamma-binding protein
    • NAP 4
    • NAP 4 Fragment
    • NAP-4
    • NAP4
    • Nck
    • Nck Ash and phospholipase C binding protein
    • Nck Ash and phospholipase C gamma binding protein
    • Nck associated protein 4
    • Nck-associated protein 4
    • NCKAP4
    • SH2 domain containing SOCS box protein
    • SOCS 7
    • SOCS-7
    • SOCS4
    • SOCS6
    • Socs7
    • SOCS7_HUMAN
    • Suppressor of cytokine signaling 7
    see all
  • Function
    Regulates signaling cascades probably through protein ubiquitination and/or sequestration. Functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. Inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. May be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Tissue specificity
    Expressed in brain and leukocytes. Also in fetal lung fibroblasts and fetal brain.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes (By similarity). It is required for IRS1 ubiquitination and subsequent proteasomal degradation.
  • Cellular localization
    Cytoplasm. Cell membrane. Nucleus. Mostly cytoplasmic, but shuttles between the cytoplasm and the nucleus. Rapidly relocalizes to the nucleus after UV irradiation. Cytoplasmic location depends upon SEPT7 presence.
  • Information by UniProt

Images

  • ab162327 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up