Recombinant human SOD2/MnSOD protein (ab93946)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKHSLPDLPYDYGALEPHINAQIMQLHHSK HHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT NLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFN KERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA IWNVINWENVTERYMACKK

Specifications

Our Abpromise guarantee covers the use of ab93946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is > 1,200 units/mg, in which one unit will inhibit the rate of reduction of cytochrome c by 50% in a coupled system, using xanthine and Xanthine oxidase at pH 7.8 at 25°C in a 1.5 ml reaction volume.

    Activity Assay

    1. Prepare a 1.5 ml reaction mix into a suitable container and pre-chill on ice before use: The final concentrations are 50mM potassium phosphate, 0.1mM ethylendiaminetetraacetic acid, 0.01mM cytochrome C, 0.05mM xanthine, 0.005 units xanthine oxidase.
    2. Equilibrate to 25°C and monitor at A550nm until the value is constant using a spectrophotometer.
    3. Add 50 ul of recombinant SOD protein in various concentrations (0.5 ug, 1 ug) in assay buffer.
    4. Mix by inversion and record the increase at A550nm for 5 minutes.
  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab93946 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Indophenoloxidase B
    • IPO B
    • IPOB
    • Manganese containing superoxide dismutase
    • Manganese SOD
    • Manganese superoxide dismutase
    • Mangano superoxide dismutase
    • Mn SOD
    • Mn superoxide dismutase
    • MNSOD
    • MVCD6
    • SOD 2
    • SOD2
    • SODM_HUMAN
    • Superoxide dismutase [Mn] mitochondrial
    • Superoxide dismutase [Mn], mitochondrial
    • Superoxide dismutase 2 mitochondrial
    see all
  • Function
    Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
  • Involvement in disease
    Genetic variation in SOD2 is associated with susceptibility to microvascular complications of diabetes type 6 (MVCD6) [MIM:612634]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities
    Belongs to the iron/manganese superoxide dismutase family.
  • Post-translational
    modifications
    Nitrated under oxidative stress. Nitration coupled with oxidation inhibits the catalytic activity.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Recombinant human SOD2/MnSOD protein images

  • 15% SDS-PAGE analysis of ab93946 (3µg)

References for Recombinant human SOD2/MnSOD protein (ab93946)

ab93946 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab93946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up