Recombinant Human Sodium / Hydrogen Exchanger 3 protein (ab114474)

Overview

  • Product nameRecombinant Human Sodium / Hydrogen Exchanger 3 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP48764
    • SpeciesHuman
    • SequenceGLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSD TEEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLA RLPPWLSPGE
    • Molecular weight38 kDa including tags
    • Amino acids670 to 779

Specifications

Our Abpromise guarantee covers the use of ab114474 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC126718
    • MGC126720
    • Na(+)/H(+) exchanger 3
    • NHE 3
    • NHE-3
    • NHE3
    • SL9A3_HUMAN
    • SLC9A 3
    • Slc9a3
    • Sodium/hydrogen exchanger 3
    • Sodium/hydrogen exchanger, apical epithelial
    • Solute carrier family 9 (sodium/hydrogen exchanger), isoform 3
    • Solute carrier family 9 (sodium/hydrogen exchanger), member 3
    • Solute carrier family 9 member 3
    see all
  • FunctionInvolved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.
  • Sequence similaritiesBelongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.
  • Post-translational
    modifications
    Phosphorylated by PKA, which inhibits activity.
  • Cellular localizationMembrane. In intestinal epithelial cells, localizes to the ileal brush border.
  • Information by UniProt

Recombinant Human Sodium / Hydrogen Exchanger 3 protein images

  • ab114474 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Sodium / Hydrogen Exchanger 3 protein (ab114474)

ab114474 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114474.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"