Recombinant Human Sodium / Hydrogen Exchanger 3 protein (ab114474)

Overview

  • Product name
    Recombinant Human Sodium / Hydrogen Exchanger 3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSD TEEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLA RLPPWLSPGE
    • Molecular weight
      38 kDa including tags
    • Amino acids
      670 to 779

Specifications

Our Abpromise guarantee covers the use of ab114474 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC126718
    • MGC126720
    • Na(+)/H(+) exchanger 3
    • NHE 3
    • NHE-3
    • NHE3
    • SL9A3_HUMAN
    • SLC9A 3
    • Slc9a3
    • Sodium/hydrogen exchanger 3
    • Sodium/hydrogen exchanger, apical epithelial
    • Solute carrier family 9 (sodium/hydrogen exchanger), isoform 3
    • Solute carrier family 9 (sodium/hydrogen exchanger), member 3
    • Solute carrier family 9 member 3
    see all
  • Function
    Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.
  • Sequence similarities
    Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.
  • Post-translational
    modifications
    Phosphorylated by PKA, which inhibits activity.
  • Cellular localization
    Membrane. In intestinal epithelial cells, localizes to the ileal brush border.
  • Information by UniProt

Images

  • ab114474 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114474 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114474.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up