Recombinant Human Sodium Potassium ATPase protein (ab157925)

Overview

  • Product name
    Recombinant Human Sodium Potassium ATPase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDSYGQQWTY EQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGI LEETLLAAFLSYTPGMDVALRMYPLKITWWLCAIPYSILIFVYDEIRKLL IRQHPDGWVERETYY
    • Amino acids
      1 to 165
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATPase Na+/K+ transporting alpha
    • adenosinetriphosphatase
    • AT1A1_HUMAN
    • ATP1A1
    • ATP1A4
    • ATP1AL2
    • ATP1B
    • ATP1B1
    • ATPase Na+/K+ transporting alpha 1 polypeptide
    • ATPase Na+/K+ transporting alpha 4 polypeptide
    • ATPase Na+/K+ transporting beta 1 polypeptide
    • ATPase, Na+/K+ transporting, alpha polypeptide-like 2
    • ATPase, Na+/K+ transporting, beta 1 polypeptide
    • Beta 1-subunit of Na(+),K(+)-ATPase
    • Na(+)/K(+) ATPase alpha-1 subunit
    • Na(+)/K(+) ATPase alpha-4 subunit
    • Na+, K+ ATPase alpha subunit
    • Na+/K+ ATPase 1
    • Na+/K+ ATPase 4
    • Na+/K+ ATPase, alpha-D polypeptide
    • Na, K-ATPase beta-1 polypeptide
    • Na, K-ATPase, alpha-A catalytic polypeptide
    • Na,K-ATPase catalytic subunit alpha-A protein
    • Na,K-ATPase subunit alpha-C
    • polypeptide-like 2
    • Sodium pump 1
    • sodium pump 4
    • Sodium pump subunit alpha-1
    • sodium pump subunit alpha-4
    • sodium pump subunit beta-1
    • sodium-potassium ATPase catalytic subunit alpha-1
    • sodium-potassium ATPase catalytic subunit alpha-4
    • sodium-potassium ATPase subunit beta 1 (non-catalytic)
    • sodium-potassium ATPase, alpha 4 polypeptide
    • sodium-potassium-ATPase, alpha 1 polypeptide
    • Sodium/potassium transporting ATPase alpha 1 chain
    • Sodium/potassium transporting ATPase subunit beta 1
    • sodium/potassium-dependent ATPase beta-1 subunit
    • sodium/potassium-transporting ATPase alpha-4 chain
    • sodium/potassium-transporting ATPase beta-1 chain
    • Sodium/potassium-transporting ATPase subunit alpha-1
    • sodium/potassium-transporting ATPase subunit alpha-4
    see all
  • Function
    This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.
  • Sequence similarities
    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily.
  • Post-translational
    modifications
    Phosphorylation on Tyr-10 modulates pumping activity.
  • Cellular localization
    Cell membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • ab157925 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up