Recombinant Human soluble IL2 Receptor beta protein (Fc Chimera) (ab174072)

Overview

  • Product name
    Recombinant Human soluble IL2 Receptor beta protein (Fc Chimera)
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCEL LPVSQASWAC NLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDF KPFENLRLMAPISLQVVHVETH RCNISWEISQASHYFERHLEFEARTL SPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEF QVRVKPLQGEFTTW SPWSQPLAFRTKPAALGKDT
    • Molecular weight
      51 kDa including tags
    • Amino acids
      27 to 239
    • Additional sequence information
      Fc Chimera, fused with Fc fragment of Human IgG1 at the C terminus.

Specifications

Our Abpromise guarantee covers the use of ab174072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 92 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 50 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD122
    • CD122 antigen
    • High affinity IL-2 receptor subunit beta
    • IL-2 receptor subunit beta
    • IL-2R subunit beta
    • IL-2RB
    • IL2 receptor
    • IL2RB
    • IL2RB_HUMAN
    • Interleukin 2 receptor beta
    • Interleukin-2 receptor subunit beta
    • P70-75
    • p75
    see all
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab174072 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 60-65 kDa due to glycosylation.

References

ab174072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up