Recombinant Human soluble IL2 Receptor gamma protein (Fc Chimera) (ab174081)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNC TWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEI HLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLEL NWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFR VRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
    • Molecular weight
      42 kDa including tags
    • Amino acids
      23 to 254
    • Tags
      proprietary tag C-Terminus
    • Additional sequence information
      Fused with Fc fragment of human IgG1 at the C-terminus. Extracellular domain. The predicted N-terminus is Leu 23. DTT-reduced Protein migrates as 80-90 kDa due to glycosylation. (AAH14972)

Specifications

Our Abpromise guarantee covers the use of ab174081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    1 mg It is recommended to reconstitute the lyophilized product in 1000 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names
    • CD132
    • Cytokine receptor common gamma chain
    • Gamma-C
    • gammaC
    • IL-2 receptor subunit gamma
    • IL-2RG
    • IL2R gamma chain
    • IL2RG
    • IMD4
    • Interleukin-2 receptor subunit gamma
    • L-2R subunit gamma
    • p64
    see all
  • Relevance
    A common subunit for the receptors for a variety of interleukins, the gamma chain is common to the IL2, IL4, IL7, IL21 and probably also the IL13 receptors. Defects in IL2RG are the cause of X-linked severe combined immunodeficiency. The biological effects of IL2R signals are much more complex than simply mediating T-cell growth. Depending on conditions, IL2R signals may also promote cell survival, effector function, and apoptosis. These sometimes contradictory effects underscore the fact that a diversity of intracellular signalling pathways are potentially activated by IL2R. There are at least 3 components of the IL2 receptor; IL2R alpha, IL2R beta, and IL2R gamma chains.
  • Cellular localization
    Membrane; single-pass type I membrane protein

Images

  • SDS-PAGE analysis of ab174081 purity

References

ab174081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up