Recombinant Human Somatostatin Receptor 2 protein (ab114373)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIY FVVCIIGLCG
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 60

Specifications

Our Abpromise guarantee covers the use of ab114373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Somatostatin receptor type 2
    • SRIF-1
    • SRIF1
    • SS-2-R
    • SS2-R
    • SS2R
    • SSR2_HUMAN
    • SST2
    • SSTR2
    see all
  • Function
    Receptor for somatostatins-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. In RIN-5F cells, this receptor inhibits calcium entry by suppressing voltage dependent calcium-channels.
  • Tissue specificity
    Cerebrum and kidney. In lesser amounts in jejunum, colon and liver.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Somatostatin Receptor 2 protein images

  • 12.5% SDS-PAGE with ab114373 at 32.23kDa stained with Coomassie Blue.

References for Recombinant Human Somatostatin Receptor 2 protein (ab114373)

ab114373 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up