Recombinant Human SORCS2 protein (ab163579)

Overview

  • Product name
    Recombinant Human SORCS2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQE LLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
    • Amino acids
      802 to 900
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1329
    • SORCS 2
    • SORCS receptor 2
    • Sortilin related VPS10 domain containing receptor 2
    • VPS10 domain receptor protein
    • VPS10 domain receptor protein SORCS 2
    • VPS10 domain-containing receptor SorCS2
    see all
  • Relevance
    SORCS2 is a member of the vacuolar protein sorting 10 (VPS10) domain containing receptor protein family. The VPS10 domain name comes from the yeast carboxypeptidase Y sorting receptor Vps10 protein. These proteins are strongly expressed in the central nervous system.
  • Cellular localization
    Membrane; Single pass type I membrane protein.

Images

  • ab163579 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up