Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPK SSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD
    • Molecular weight
      37 kDa including tags
    • Amino acids
      82 to 181
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C11orf32
    • FLJ21930
    • FLJ39258
    • gp250
    • LDLR relative with 11 ligand binding repeats
    • LDLR relative with 11 ligand-binding repeats
    • Low density lipoprotein receptor relative with 11 ligand binding repeats
    • Low-density lipoprotein receptor relative with 11 ligand-binding repeats
    • LR 11
    • LR11
    • LRP 9
    • LRP9
    • Mosaic protein LR11
    • SORL 1
    • SORL_HUMAN
    • SORL1
    • SorLA
    • SorLA 1
    • SorLA-1
    • Sortilin related receptor
    • Sortilin related receptor L(DLR class) A repeats containing
    • Sortilin-related receptor
    • Sorting protein related receptor containing LDLR class A repeats
    • Sorting protein-related receptor containing LDLR class A repeats
    see all
  • Function
    Likely to be a multifunctional endocytic receptor, that may be implicated in the uptake of lipoproteins and of proteases. Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. Binds the receptor-associated protein (RAP). Could play a role in cell-cell interaction.
  • Tissue specificity
    Expressed mainly in brain, where it is most abundant in the cerebellum, cerebral cortex and the occipital pole; low expression in the putamen and the thalamus. According to PubMed:9157966, found in spinal cord, testis, liver, kidney and pancreas with detectable levels in placenta, lung and heart. According to PubMed:8940146, expressed in the prostate, ovary, thyroid and spleen, but not found in kidney, liver, lung, skeletal muscle, bone marrow and adrenals.
  • Sequence similarities
    Belongs to the SORL1 family.
    Contains 5 BNR repeats.
    Contains 1 EGF-like domain.
    Contains 6 fibronectin type-III domains.
    Contains 11 LDL-receptor class A domains.
    Contains 5 LDL-receptor class B repeats.
  • Post-translational
    modifications
    The propeptide removed in the N-terminus may be cleaved by furin or homologous proteases.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114683 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up