Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVQQRGARAKRDGGPPPPGPGPAEEGAREPGWCKTPSGHIKRPMNAFMVW SQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH MADYPDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRA AGGPLGGGAAAPEDDDEDDDEELLEVRLVETPGRELWRMVPAGRAARGQA ERAQGPSGEGAAAAAAASPTPSEDEEPEEEEEEAAAAEEGEEETVASGEE SLGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIA GDWRPSSIADLVFTY
    • Amino acids
      1 to 315
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homo sapiens SRY (sex determining region Y) box 12
    • Protein SOX-22
    • SOX 12
    • SOX 12 protein
    • SOX 22
    • SOX 22 protein
    • sox12
    • SOX12 protein
    • SOX12_HUMAN
    • SOX22
    • SOX22 protein
    • SRY (sex determining region Y) box 12
    • SRY (sex determining region Y) box 22
    • SRY box 12
    • SRY box 22
    • SRY related HMG box gene 22
    • Transcription factor SOX 12
    • Transcription factor Sox-12
    see all
  • Function
    Binds to the sequence 5'-AACAAT-3'.
  • Tissue specificity
    Expressed most abundantly in the CNS. Also expressed in fetal brain and kidney and adult heart, pancreas, testis and ovary. Other tissues were only weakly positive.
  • Sequence similarities
    Contains 1 HMG box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159562 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159562 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up