Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLG KRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
    • Amino acids
      45 to 136
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ecotropic viral integration site 16
    • EVI 16
    • EVI16
    • Sox4
    • SOX4_HUMAN
    • SRY (sex determining region Y) box 4
    • SRY box containing gene 4
    • SRY related HMG box gene 4
    • Transcription factor SOX-4
    see all
  • Function
    Transcriptional activator that binds with high affinity to the T-cell enhancer motif 5'-AACAAAG-3' motif.
  • Tissue specificity
    Testis, brain, and heart.
  • Sequence similarities
    Contains 1 HMG box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159560 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up