Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23497
    • SpeciesHuman
    • SequenceMAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLY DIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
    • Molecular weight36 kDa including tags
    • Amino acids1 to 98

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686E07254
    • FLJ00340
    • FLJ34579
    • Lysp100b
    • Nuclear antigen Sp100
    • Nuclear autoantigen Sp 100
    • Nuclear autoantigen Sp-100
    • Nuclear autoantigen Sp100
    • Nuclear dot associated Sp100 protein
    • Nuclear dot-associated Sp100 protein
    • SP 100
    • SP100
    • SP100 HMG nuclear autoantigen
    • SP100 nuclear antigen
    • SP100_HUMAN
    • Speckled 100 kDa
    see all
  • FunctionMay play a role in the control of gene expression.
  • Tissue specificityWidely expressed. Sp100-B is expressed only in spleen, tonsil, thymus, mature B-cell line and some T-cell line, but not in brain, liver, muscle or non-lymphoid cell lines.
  • Sequence similaritiesContains 2 HMG box DNA-binding domains.
    Contains 1 HSR domain.
    Contains 1 SAND domain.
  • DomainThe HSR domain is important for the nuclear body targeting as well as for the dimerization.
    Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain.
  • Post-translational
    modifications
    Sumoylated. Sumoylation depends on a functional nuclear localization signal but is not necessary for nuclear import or nuclear body targeting.
  • Cellular localizationNucleus > PML body. Found in the nuclear body, also known as nuclear domain 10 (ND10), PML oncogenic domain (POD), nuclear dots (ND) and KR body. The nuclear body is a nucleoplasmic structure of punctate shape, which varies in size and number. Induction by interferon and may be cell cycle stages modulate the subnuclear localization of the isoforms.
  • Information by UniProt

Recombinant Human SP100 protein images

  • 12.5% SDS-PAGE showing ab114588 at approximately 36.41kDa stained with Coomassie Blue.

References for Recombinant Human SP100 protein (ab114588)

ab114588 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"