Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLY DIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 98

Specifications

Our Abpromise guarantee covers the use of ab114588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686E07254
    • FLJ00340
    • FLJ34579
    • Lysp100b
    • Nuclear antigen Sp100
    • Nuclear autoantigen Sp 100
    • Nuclear autoantigen Sp-100
    • Nuclear autoantigen Sp100
    • Nuclear dot associated Sp100 protein
    • Nuclear dot-associated Sp100 protein
    • SP 100
    • SP100
    • SP100 HMG nuclear autoantigen
    • SP100 nuclear antigen
    • SP100_HUMAN
    • Speckled 100 kDa
    see all
  • Function
    May play a role in the control of gene expression.
  • Tissue specificity
    Widely expressed. Sp100-B is expressed only in spleen, tonsil, thymus, mature B-cell line and some T-cell line, but not in brain, liver, muscle or non-lymphoid cell lines.
  • Sequence similarities
    Contains 2 HMG box DNA-binding domains.
    Contains 1 HSR domain.
    Contains 1 SAND domain.
  • Domain
    The HSR domain is important for the nuclear body targeting as well as for the dimerization.
    Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain.
  • Post-translational
    modifications
    Sumoylated. Sumoylation depends on a functional nuclear localization signal but is not necessary for nuclear import or nuclear body targeting.
  • Cellular localization
    Nucleus > PML body. Found in the nuclear body, also known as nuclear domain 10 (ND10), PML oncogenic domain (POD), nuclear dots (ND) and KR body. The nuclear body is a nucleoplasmic structure of punctate shape, which varies in size and number. Induction by interferon and may be cell cycle stages modulate the subnuclear localization of the isoforms.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114588 at approximately 36.41kDa stained with Coomassie Blue.

References

ab114588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up