Overview

  • Product nameRecombinant Human SP110 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9HB58
    • SpeciesHuman
    • SequenceTPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQ KKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPST PRRVTQGAAS
    • Molecular weight38 kDa including tags
    • Amino acids271 to 380

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ22835
    • IFI 41
    • IFI 75
    • IFI41
    • IFI75
    • Interferon induced protein 41
    • Interferon induced protein 41 30kD
    • Interferon induced protein 41/75
    • Interferon induced protein 75
    • Interferon induced protein 75 52kD
    • Interferon-induced protein 41/75
    • IPR 1
    • IPR1
    • Phosphoprotein 41
    • Phosphoprotein 75
    • SP 110
    • SP110
    • Sp110 nuclear body protein
    • SP110_HUMAN
    • Speckled 110 kDa
    • Transcriptional coactivator Sp110
    • VODI
    see all
  • FunctionTranscription factor. May be a nuclear hormone receptor coactivator. Enhances transcription of genes with retinoic acid response elements (RARE).
  • Tissue specificityHighly expressed in peripheral blood leukocytes and spleen. Detected at intermediate levels in thymus, prostate, testis, ovary, small intestine and colon, and at low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Involvement in diseaseDefects in SP110 are the cause of hepatic venoocclusive disease with immunodeficiency (VODI) [MIM:235550]. VODI is an autosomal recessive primary immunodeficiency associated with hepatic vascular occlusion and fibrosis. The immunodeficiency is characterized by severe hypogammaglobulinemia, combined T and B cell immunodeficiency, absent lymph node germinal centers, and absent tissue plasma cells.
  • Sequence similaritiesContains 1 bromo domain.
    Contains 1 HSR domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 SAND domain.
  • Post-translational
    modifications
    Phosphorylated (isoform 2).
  • Cellular localizationNucleus. Found in the nuclear body.
  • Information by UniProt

Recombinant Human SP110 protein images

  • SDS-PAGE analysis of ab114669 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human SP110 protein (ab114669)

ab114669 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"