Recombinant Human SP2 transcription factor protein (ab117031)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ02086
    • SpeciesHuman
    • SequenceMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVEAAVTPP APPQPTPRKLVPIKPAPLPLSPGKNSFGILSSKGNILQIQGSQLSASYPG GQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQ IIPGTNQAIITPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGG GNVTLTLPVNNLVNASDTGAPTQLLTASCQTGMLNSTRMFLFLAFINVL
    • Molecular weight53 kDa including tags
    • Amino acids1 to 249

Specifications

Our Abpromise guarantee covers the use of ab117031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kiaa0048
    • OTTHUMP00000196580
    • SP2
    • SP2_HUMAN
    • SPECIFICITY PROTEIN 2
    • Transcription factor Sp2
    see all
  • FunctionBinds to GC box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites.
  • Sequence similaritiesBelongs to the Sp1 C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SP2 transcription factor protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117031 at approximately 53.46 kDa.

References for Recombinant Human SP2 transcription factor protein (ab117031)

ab117031 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"