Overview

  • Product name
    Recombinant Human SPAG4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDL QKTSHDYADRNTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEGDQGQ VVIQLPGRVQ
    • Amino acids
      221 to 330
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • acrosomal protein ACR55
    • cancer/testis antigen 127
    • CT127
    • OTTHUMP00000030768
    • OTTHUMP00000204168
    • Outer dense fiber-associated protein SPAG4
    • Sad1 and UNC84 domain containing 4
    • Spag4
    • SPAG4_HUMAN
    • Sperm associated antigen 4
    • sperm tail protein
    • Sperm-associated antigen 4 protein
    • SUN domain-containing protein 4
    • SUN4
    see all
  • Function
    May assist the organization and assembly of outer dense fibers (ODFs), a specific structure of the sperm tail.
  • Sequence similarities
    Contains 1 SUN domain.
  • Cellular localization
    Membrane. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > flagellum axoneme. In spermatids, it is localized in the transient manchette and in the axoneme of elongating spermatids and epididymal sperm.
  • Information by UniProt

Images

  • ab159567 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up