Overview

  • Product name
    Recombinant Human SPAG6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLL LDVVPTIQQIAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYK KAAAFVLRAVGKHSPQLAQAIVDCGALDTLVICLEDFDPGVKEAAAWALR YIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKGIAASALSDIVKHSPE LAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA EIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVVNAGGVAAVID CIGSCKGNTRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSVCLSEEPED HIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTESSEDLQVKS KKAIKNILQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSA EGGQLSTT
    • Amino acids
      1 to 458
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160554 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • axoneme central apparatus protein
    • DKFZp434I153
    • MGC26276
    • PF16
    • PF16 protein homolog
    • Protein PF16 homolog
    • Repro SA 1
    • Repro-SA-1
    • SPAG6
    • SPAG6_HUMAN
    • Sperm associated antigen 6
    • Sperm flagellar protein
    • Sperm-associated antigen 6
    see all
  • Function
    Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
  • Tissue specificity
    Highly expressed in testis.
  • Sequence similarities
    Contains 8 ARM repeats.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection > cilium > flagellum. Associated with microtubules. Detected on the sperm flagellum.
  • Information by UniProt

Images

  • ab160554 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160554 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160554.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up