Recombinant Human SPANXB1 protein (ab166585)

Overview

  • Product name
    Recombinant Human SPANXB1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKT SESSTILVVRYRRNVKRTSPEELVNDHARENRINPDQMEEEEFIEITTER PKK
    • Amino acids
      1 to 103
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B1
    • Cancer/testis antigen 11.2
    • Cancer/testis antigen family 11, member 2
    • CT11.2
    • hCG2036708
    • Nuclear associated protein SPAN Xb
    • Nuclear-associated protein SPAN-Xb
    • Nuclear-associated protein SPAN-Xf
    • SPAN Xb protein
    • SPAN Xf
    • SPANX
    • SPANX B
    • SPANX C
    • SPANX F
    • SPANX family member B/F
    • SPANX family, member B1
    • SPANX family, member B2
    • SPANX family, member F1
    • SPANX-B
    • SPANX-F
    • SPANXB
    • SPANXB2
    • SPANXF
    • SPANXF1
    • Sperm protein associated with the nucleus on the X chromosome B/F
    • Sperm protein associated with the nucleus, X chromosome, family
    • Sperm protein associated with the nucleus, X chromosome, family member B1
    • Sperm protein associated with the nucleus, X chromosome, family member B2
    • SPNXB_HUMAN
    see all
  • Tissue specificity
    Detected in testis and sperm.
  • Sequence similarities
    Belongs to the SPAN-X family.
  • Developmental stage
    Detected in round and elongating spermatids.
  • Cellular localization
    Cytoplasm. Nucleus. Associated with nuclear craters.
  • Information by UniProt

Images

  • ab166585 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up