Overview

Description

  • Nature
    Recombinant
  • Source
    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVV AENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNK TFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRM RDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLA RDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTT RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
    • Molecular weight
      44 kDa
    • Amino acids
      18 to 303

Specifications

Our Abpromise guarantee covers the use of ab107952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Determined by its ability to increase alkaline phosphatase activity in differentiating MC3T3 cells using a concentration of 0.5-0.7 µg/ml.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 98 % SDS-PAGE.
    Purity is greater than 98% by SDS-PAGE gel and HPLC analyses.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10mM Sodium phosphate, pH 7.6

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml

General Info

  • Alternative names
    • AA517111
    • Basement membrane protein 40
    • Basement-membrane protein 40
    • BM 40
    • BM-40
    • BM40
    • Cysteine rich protein
    • hm:zeh0062
    • MGC128090
    • OI17
    • ON
    • Osteonectin
    • Secreted acidic cystein rich glycoprotein
    • Secreted protein acidic and cysteine rich
    • Secreted protein acidic and rich in cysteine
    • Secreted protein acidic cysteine rich
    • Secreted protein acidic cysteine rich (osteonectin)
    • SPARC
    • SPRC
    • SPRC_HUMAN
    see all
  • Function
    Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.
  • Sequence similarities
    Belongs to the SPARC family.
    Contains 1 EF-hand domain.
    Contains 1 follistatin-like domain.
    Contains 1 Kazal-like domain.
  • Developmental stage
    Expressed at high levels in tissues undergoing morphogenesis, remodeling and wound repair.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane. In or around the basement membrane.
  • Information by UniProt

References

ab107952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up