Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVV AENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNK TFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRM RDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLA RDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTT RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVIVDHHHHHH
    • Molecular weight
      34 kDa including tags
    • Amino acids
      18 to 303
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • AA517111
    • Basement membrane protein 40
    • Basement-membrane protein 40
    • BM 40
    • BM-40
    • BM40
    • Cysteine rich protein
    • hm:zeh0062
    • MGC128090
    • OI17
    • ON
    • Osteonectin
    • Secreted acidic cystein rich glycoprotein
    • Secreted protein acidic and cysteine rich
    • Secreted protein acidic and rich in cysteine
    • Secreted protein acidic cysteine rich
    • Secreted protein acidic cysteine rich (osteonectin)
    • SPARC
    • SPRC
    • SPRC_HUMAN
    see all
  • Function
    Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.
  • Sequence similarities
    Belongs to the SPARC family.
    Contains 1 EF-hand domain.
    Contains 1 follistatin-like domain.
    Contains 1 Kazal-like domain.
  • Developmental stage
    Expressed at high levels in tissues undergoing morphogenesis, remodeling and wound repair.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane. In or around the basement membrane.
  • Information by UniProt

References

ab151903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up