Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDG AEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEF EKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDS ELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEA GDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAP LIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
    • Molecular weight
      34 kDa including tags
    • Amino acids
      19 to 303
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab201437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    > 95 % by HPLC.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    0.2µm filtered

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names
    • AA517111
    • Basement membrane protein 40
    • Basement-membrane protein 40
    • BM 40
    • BM-40
    • BM40
    • Cysteine rich protein
    • hm:zeh0062
    • MGC128090
    • OI17
    • ON
    • Osteonectin
    • Secreted acidic cystein rich glycoprotein
    • Secreted protein acidic and cysteine rich
    • Secreted protein acidic and rich in cysteine
    • Secreted protein acidic cysteine rich
    • Secreted protein acidic cysteine rich (osteonectin)
    • SPARC
    • SPRC
    • SPRC_HUMAN
    see all
  • Function
    Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.
  • Sequence similarities
    Belongs to the SPARC family.
    Contains 1 EF-hand domain.
    Contains 1 follistatin-like domain.
    Contains 1 Kazal-like domain.
  • Developmental stage
    Expressed at high levels in tissues undergoing morphogenesis, remodeling and wound repair.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane. In or around the basement membrane.
  • Information by UniProt

References

ab201437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up