Recombinant Human SPATA2 protein (ab160671)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGKPSSMDTKFKDDLFRKYVQFHESKVDTTTSRQRPGSDECLRVAASTLL SLHKVDPFYRFRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLF LYPWKKEFRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGYTPELGTAYKL RELVETLQVKMVSFELFLAKVECEQMLEIHSQVKDKGYSELDIVSERKSS AEDVRGCSDALRRRAEGREHLTASMSRVALQKSASERAAKDYYKPRVTKP SRSVDAYDSYWESRKPPLKASLSLRKEPVATDVGDDLKDEIIRPSPSLLT MASSPHGSPDVLPPASPSNGPALLRGTYFSTQDDVDLYTDSEPRATYRRQ DALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDS LLTCPPASKPSAFPSKASTHDSLAHGASLREKYPGQTQGLDRLPHLHSKS KPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDPCYKKSELHK FMPNNQLNYKSTQLSHLVYR
    • Amino acids
      1 to 520
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160671 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ13167
    • KIAA0757
    • PD 1
    • PD1
    • PPP1R145
    • Protein phosphatase 1 regulatory subunit 145
    • SPAT2_HUMAN
    • SPATA 2
    • SPATA2
    • Spermatogenesis associated 2
    • Spermatogenesis associated PD1
    • Spermatogenesis associated protein 2
    • Spermatogenesis associated protein PD1
    • Spermatogenesis-associated protein 2
    • Spermatogenesis-associated protein PD1
    • Tamo
    see all
  • Function
    May have a role in the regulation of spermatogenesis.
  • Tissue specificity
    Highly expressed in Sertoli cells, but not detected in spermatogenic cells. Low expression in spleen, thymus and prostate.
  • Sequence similarities
    Belongs to the SPATA2 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160671 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160671 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160671.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up