Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPAT PEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQA PAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDW SPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGD VLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIH LWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAM NYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
    • Amino acids
      1 to 335
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA375E1.3
    • PDEF
    • Prostate derived Ets factor
    • PROSTATE EPITHELIUM SPECIFIC ETS TRANSCRIPTION FACTOR
    • Prostate epithelium-specific Ets transcription factor
    • Prostate specific Ets
    • Prostate-derived Ets factor
    • Prostate-specific Ets
    • PSE
    • RP11-375E1__A.3
    • SAM POINTED DOMAIN CONTAINING ETS TRANSCRIPTION FACTOR
    • SAM pointed domain-containing Ets transcription factor
    • Spdef
    • SPDEF_HUMAN
    see all
  • Function
    May function as an androgen-independent transactivator of the prostate-specific antigen (PSA) promoter. Binds to 5'-GGAT-3' DNA sequences. May play a role in the regulation of the prostate gland and/or prostate cancer development. Acts as a transcriptional activator for SERPINB5 promoter.
  • Tissue specificity
    Expressed in a very restricted set of primarily hormone-regulated epithelial tissues with particularly high expression in the prostate gland. Significantly lower expression is seen in other hormone regulated tissues such as mammary gland, salivary gland, and ovary. Expressed in prostate carcinoma cells.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161790 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up