Overview

  • Product name
    Recombinant Human SPDYA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT HNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYL LAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALG KNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERS VHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSS HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK KDKSMEWFTGSEE
    • Amino acids
      1 to 313
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hSpy/Ringo A
    • MGC110856
    • MGC57218
    • OTTHUMP00000082662
    • OTTHUMP00000082663
    • OTTHUMP00000082664
    • Rapid inducer of G2/M progression in oocytes A
    • RINGO A
    • RINGO3
    • SPDY1
    • Speedy A
    • Speedy homolog 1 (Drosophila)
    • Speedy homolog A
    • Speedy homolog A (Xenopus laevis)
    • Speedy-1
    • SPY1
    see all
  • Relevance
    SPDYA (speedy homolog A (Drosophila)) regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
  • Cellular localization
    Nuclear

Images

  • ab166002 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up