Recombinant Human Speedy protein C (ab166404)

Overview

  • Product name
    Recombinant Human Speedy protein C
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGF LRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAH LKLSEYTHSSLFLALYLANDMEEDLEGPKCEIFPWALGKDWCLRVGKFLH QRDKLWARMGFRAVVSRQCCEEVMAKEPFHWAWTRDRRPHHGGVQRVCPQ VPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSLTSECHRPPSQ NYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH
    • Amino acids
      1 to 293
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hSpy/Ringo C
    • Rapid inducer of G2/M progression in oocytes C
    • Rapid inducer of G2/M progression in oocytes, Xenopus, homolog of, C
    • RINGO C
    • Ringo2
    • SPDYC
    • SPDYC_HUMAN
    • speedy C
    • speedy homolog C
    • Speedy protein C
    • Speedy, Xenopus, homolog of, C
    see all
  • Function
    Promotes progression through the cell cycle via binding and activation of CDK1 and CDK2.
  • Tissue specificity
    Expressed in a variety of tissues including bone marrow, kidney, small intestine, liver, placenta and testis.
  • Sequence similarities
    Belongs to the Speedy/Ringo family.
  • Domain
    The C-terminus is required for CDK2-activation, but not CDK2-binding.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab166404 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up