Recombinant Human Spermine synthase protein (ab116202)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP52788
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMAAARHSTLDFMLGAKADGETILKGL QSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSY DGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPT ADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLA YTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVI DGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVIND LTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALS LYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
    • Molecular weight44 kDa including tags
    • Amino acids1 to 366
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab116202 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • MRSR
    • SMS
    • Snyder Robinson X linked mental retardation syndrome
    • Spermidine aminopropyltransferase
    • Spermine synthase
    • SPMSY
    • SpS
    • SPSY_HUMAN
    • SRS
    see all
  • FunctionRequired for normal viability, growth and fertility.
  • PathwayAmine and polyamine biosynthesis; spermine biosynthesis; spermine from spermidine: step 1/1.
  • Involvement in diseaseDefects in SMS are the cause of Snyder-Robinson syndrome (SRS) [MIM:309583]; also known as X-linked mental retardation Snyder-Robinson type. SRS is characterized by moderate intellectual deficit, hypotonia, an unsteady gait, osteoporosis, kyphoscoliosis and facial asymmetry. Transmission is X-linked recessive.
  • Sequence similaritiesBelongs to the spermidine/spermine synthase family.
  • DomainComposed of 3 domains: the N-terminal domain has structural similarity to S-adenosylmethionine decarboxylase, the central domain is made up of four beta strands and the C-terminal domain is similar in structure to spermidine synthase. The N- and C-terminal domains are both required for activity.
  • Information by UniProt

Recombinant Human Spermine synthase protein images

  • 15% SDS-PAGE analysis of 3 µg ab116202.

References for Recombinant Human Spermine synthase protein (ab116202)

ab116202 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"