Recombinant Human Spermine synthase protein (ab116763)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP52788
    • SpeciesHuman
    • SequenceMAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLAT YTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKEL SQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNI KILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGG DGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQ VLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILD LSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPS YLELWVFYTVWKKAKP
    • Molecular weight66 kDa including tags
    • Amino acids1 to 366

Specifications

Our Abpromise guarantee covers the use of ab116763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • MRSR
    • SMS
    • Snyder Robinson X linked mental retardation syndrome
    • Spermidine aminopropyltransferase
    • Spermine synthase
    • SPMSY
    • SpS
    • SPSY_HUMAN
    • SRS
    see all
  • FunctionRequired for normal viability, growth and fertility.
  • PathwayAmine and polyamine biosynthesis; spermine biosynthesis; spermine from spermidine: step 1/1.
  • Involvement in diseaseDefects in SMS are the cause of Snyder-Robinson syndrome (SRS) [MIM:309583]; also known as X-linked mental retardation Snyder-Robinson type. SRS is characterized by moderate intellectual deficit, hypotonia, an unsteady gait, osteoporosis, kyphoscoliosis and facial asymmetry. Transmission is X-linked recessive.
  • Sequence similaritiesBelongs to the spermidine/spermine synthase family.
  • DomainComposed of 3 domains: the N-terminal domain has structural similarity to S-adenosylmethionine decarboxylase, the central domain is made up of four beta strands and the C-terminal domain is similar in structure to spermidine synthase. The N- and C-terminal domains are both required for activity.
  • Information by UniProt

Recombinant Human Spermine synthase protein images

  • 12.5% SDS-PAGE analysis of ab116763 at approximately 66.37kDa, stained with Coomassie Blue.

References for Recombinant Human Spermine synthase protein (ab116763)

ab116763 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"