Recombinant Human Spermine synthase protein (ab116763)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLAT YTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKEL SQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNI KILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGG DGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQ VLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILD LSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPS YLELWVFYTVWKKAKP
    • Molecular weight
      66 kDa including tags
    • Amino acids
      1 to 366

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • MRSR
    • SMS
    • Snyder Robinson X linked mental retardation syndrome
    • Spermidine aminopropyltransferase
    • Spermine synthase
    • SPMSY
    • SpS
    • SPSY_HUMAN
    • SRS
    see all
  • Function
    Required for normal viability, growth and fertility.
  • Pathway
    Amine and polyamine biosynthesis; spermine biosynthesis; spermine from spermidine: step 1/1.
  • Involvement in disease
    Defects in SMS are the cause of Snyder-Robinson syndrome (SRS) [MIM:309583]; also known as X-linked mental retardation Snyder-Robinson type. SRS is characterized by moderate intellectual deficit, hypotonia, an unsteady gait, osteoporosis, kyphoscoliosis and facial asymmetry. Transmission is X-linked recessive.
  • Sequence similarities
    Belongs to the spermidine/spermine synthase family.
  • Domain
    Composed of 3 domains: the N-terminal domain has structural similarity to S-adenosylmethionine decarboxylase, the central domain is made up of four beta strands and the C-terminal domain is similar in structure to spermidine synthase. The N- and C-terminal domains are both required for activity.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab116763 at approximately 66.37kDa, stained with Coomassie Blue.

References

ab116763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up