Overview

  • Product name
    Recombinant Human Spic protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTCVEQDKLGQAFEDAFEVLRQHSTGDLQYSPDYRNYLALINHRPHVKGN SSCYGVLPTEEPVYNWRTVINSAADFYFEGNIHQSLQNITENQLVQPTLL QQKGGKGRKKLRLFEYLHESLYNPEMASCIQWVDKTKGIFQFVSKNKEKL AELWGKRKGNRKTMTYQKMARALRNYGRSGEITKIRRKLTYQFSEAILQR LSPSYFLGKEIFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHDC
    • Amino acids
      1 to 248
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AU019198
    • C76795
    • MGC40611
    • MGC80555
    • Prf
    • Pu.1 related factor
    • Spi C
    • Spi C transcription factor
    • Spi-C transcription factor (Spi-1/PU.1 related)
    • spiC
    • SPIC_HUMAN
    • Transcription factor Spi-C
    see all
  • Function
    Controls the development of red pulp macrophages required for red blood cells recycling and iron homeostasis. Transcription factor that binds to the PU-box, a purine-rich DNA sequence (5'-GAGGA[AT]-3') that can act as a lymphoid-specific enhancer. Regulates VCAM1 gene expression.
  • Tissue specificity
    Preferentially detected in fetal and adult spleen, lymph nodes and at lower levels in bone marrow and fetal liver.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165176 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up