Recombinant Human SPIN2A protein (ab162751)

Overview

  • Product name
    Recombinant Human SPIN2A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIV GCRISHGWKEGDEPITQWKGTVLDQVPINPSLYLVKYDGIDCVYGLELHR DERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGEHGSKDEWRGM VLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTER EPGGVVDGLIGKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIY VYDLVKKS
    • Amino acids
      1 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Centromeric spin2 copy
    • dJ323P24.1
    • DXF34
    • Protein DXF34
    • RP3-323P24.1
    • RP3-323P24.2
    • SPIN2
    • Spindlin 2A
    • Spindlin family, member 2A
    • Spindlin homolog 2
    • Spindlin like protein 2
    • Spindlin like protein 2A
    • TDRD25
    see all
  • Relevance
    May be involved in the regulation of cell cycle progression

Images

  • ab162751 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up