Recombinant Human SPINK1 protein (ab152041)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILI QKSGPCVDHH HHHH
    • Molecular weight
      7 kDa including tags
    • Amino acids
      24 to 79
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab152041 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
    Supplied as a 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 6.00
    Constituents: 0.392% MES, 0.05% Brij, 0.02% Calcium chloride, 0.02% DTT, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • ISK1_HUMAN
    • Pancreatic secretory trypsin inhibitor
    • Pancreatic serine protease inhibitor Kazal
    • PCTT
    • PSTI
    • Serine protease inhibitor Kazal type 1
    • Serine protease inhibitor Kazal-type 1
    • Spink 3
    • SPINK1
    • Spink3
    • TaTI
    • TCP
    • Tumor associated trypsin inhibitor
    • Tumor-associated trypsin inhibitor
    see all
  • Function
    Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:7142173). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.
    In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.
  • Involvement in disease
    Pancreatitis, hereditary
    Tropical calcific pancreatitis
  • Sequence similarities
    Contains 1 Kazal-like domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab152041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up