Recombinant Human SPINK1 protein (ab152702)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTD GNTYPNECVLCFENRKRQTSILIQKSGPC
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 79

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152702 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ISK1_HUMAN
    • Pancreatic secretory trypsin inhibitor
    • Pancreatic serine protease inhibitor Kazal
    • PCTT
    • PSTI
    • Serine protease inhibitor Kazal type 1
    • Serine protease inhibitor Kazal-type 1
    • Spink 3
    • SPINK1
    • Spink3
    • TaTI
    • TCP
    • Tumor associated trypsin inhibitor
    • Tumor-associated trypsin inhibitor
    see all
  • Function
    Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:7142173). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.
    In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.
  • Involvement in disease
    Pancreatitis, hereditary
    Tropical calcific pancreatitis
  • Sequence similarities
    Contains 1 Kazal-like domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152702 stained with Coomassie Blue.

References

ab152702 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152702.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up